} "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#messageview_5", "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", ] "action" : "pulsate" ] }); "context" : "", "context" : "envParam:selectedMessage", "event" : "removeMessageUserEmailSubscription", ', 'ajax'); "actions" : [ "disableLinks" : "false", "context" : "envParam:quiltName", ] "action" : "rerender" { ;(function($) { "eventActions" : [ ], }, }, }, { "event" : "deleteMessage", "context" : "", ] "truncateBodyRetainsHtml" : "false", "actions" : [ if ( neededkeys[count] == key ) { { $(document).ready(function(){ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/82285/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ovanOirO9qo7gVsIgcZa2zQzhHGrEJurA5oyGAFukbM. }, "event" : "addMessageUserEmailSubscription", "parameters" : { "componentId" : "forums.widget.message-view", "initiatorDataMatcher" : "data-lia-message-uid" "componentId" : "forums.widget.message-view", "action" : "rerender" "action" : "rerender" { "action" : "pulsate" setWarning(pagerId); { } LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '8ROt0d0ssaypiSVvfBQ4nzUfJEx2xlm9h2_QM1zNB9E. ] "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" setWarning(pagerId); function clearWarning(pagerId) { "actions" : [ } { } "context" : "", "actions" : [ { { "disableLabelLinks" : "false", Willkommen bei CallYa Flex Mit der CallYa Flex-App stellst Du Dir ganz einfach Deinen persönlichen Tarif zusammen. "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", ] } "actions" : [ }, "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "event" : "AcceptSolutionAction", "action" : "pulsate" { }, } { createStorage("true"); "event" : "unapproveMessage", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" }, }, }, } "disallowZeroCount" : "false", Execute whatever should happen when entering the right sequence }, "selector" : "#messageview_8", "event" : "approveMessage", "context" : "envParam:quiltName,expandedQuiltName", }, { { "initiatorDataMatcher" : "data-lia-kudos-id" } "event" : "addMessageUserEmailSubscription", }, } "linkDisabled" : "false" }, resetMenu(); { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { ] ], } ] "selector" : "#messageview_5", "event" : "kudoEntity", } "context" : "", "parameters" : { { "event" : "removeThreadUserEmailSubscription", }, "event" : "expandMessage", { "action" : "rerender" "context" : "envParam:entity", setWarning(pagerId); "action" : "rerender" } { }, "context" : "", "event" : "unapproveMessage", { "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "event" : "ProductAnswerComment", { "context" : "", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_7","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2026187}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2026273}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2026670}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2039237}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2039453}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2039679}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2084628}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2084635}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114202}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114419}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_77","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_79","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_81","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { }, } { ] } $(document).ready(function(){ { "context" : "envParam:selectedMessage", { { ] ], { "context" : "", { { "actions" : [ })(LITHIUM.jQuery); { ] ], "action" : "rerender" "linkDisabled" : "false" "context" : "", }, "useCountToKudo" : "false", "action" : "rerender" } "event" : "QuickReply", { }, }); "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" "event" : "approveMessage", "actions" : [ { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ Bist du sicher, dass du fortfahren möchtest? { "actions" : [ function setWarning(pagerId) { "actions" : [ { ] "event" : "removeMessageUserEmailSubscription", { "event" : "deleteMessage", "displayStyle" : "horizontal", { }, { } window.location = "https://forum.vodafone.de/t5/CallYa/Callya-flex-app-quot-Leider-gab-es-einen-Fehler-quot/td-p/2023943" + "/page/" + val; "event" : "AcceptSolutionAction", "eventActions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2039679,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. o.innerHTML = "Page must be an integer number. ] ] { ] } "event" : "MessagesWidgetEditAction", "action" : "rerender" }, "context" : "", "event" : "kudoEntity", "eventActions" : [ }, { "actions" : [ // --> "context" : "", ] "action" : "rerender" "action" : "pulsate" { "action" : "rerender" } { "context" : "envParam:quiltName,expandedQuiltName", "event" : "editProductMessage", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } "action" : "rerender" { "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName", { "event" : "addThreadUserEmailSubscription", }, } { "context" : "", }, { "action" : "addClassName" { "revokeMode" : "true", "action" : "rerender" "eventActions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ { }, "displaySubject" : "true", { ] "action" : "rerender" { "actions" : [ }, { ] "action" : "rerender" }, "event" : "unapproveMessage", }, "useSimpleView" : "false", "showCountOnly" : "false", }); "actions" : [ "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", }, } }); "context" : "", } "action" : "rerender" "event" : "expandMessage", } window.location.replace('/t5/user/userloginpage'); "useSubjectIcons" : "true", { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" }, ] "context" : "", "event" : "ProductMessageEdit", "disableLabelLinks" : "false", "actions" : [ ], { ] "context" : "", }, "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" "event" : "approveMessage", "context" : "envParam:quiltName", } }, "event" : "editProductMessage", "context" : "lia-deleted-state", { setWarning(pagerId); "actions" : [ "disableKudosForAnonUser" : "false", "actions" : [ { }, "context" : "envParam:quiltName,expandedQuiltName", "useCountToKudo" : "false", "context" : "", "actions" : [ { { ', 'ajax'); "context" : "envParam:feedbackData", "event" : "markAsSpamWithoutRedirect", }); } ] "initiatorBinding" : true, "context" : "", "actions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_31b669e4787187","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_31b669e4787187_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { } { "actions" : [ }); "useTruncatedSubject" : "true", "componentId" : "kudos.widget.button", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ if ( key == neededkeys[0] ) { "action" : "rerender" { "event" : "markAsSpamWithoutRedirect", "actions" : [ "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233718}); }); "parameters" : { ] "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" }, { "actions" : [ "actions" : [ }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "deleteMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/82285/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mK1wp-Pkm5fT62Brib0ksthTZFfSD0eANJwwzsxj8qw. logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" "event" : "MessagesWidgetCommentForm", "event" : "QuickReply", "action" : "rerender" "context" : "envParam:quiltName", }, ] "action" : "rerender" "context" : "envParam:selectedMessage", } "displaySubject" : "true", "action" : "rerender" } "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" var handleOpen = function(event) { //if(height > 430) { ', 'ajax'); "event" : "unapproveMessage", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'g3cnIe8zpxcbSYxr9DouIIWYyuKAJgADxTH0qV5YyqA. }, "event" : "QuickReply", "actions" : [ "context" : "", "kudosLinksDisabled" : "false", { }, "disallowZeroCount" : "false", "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.useTickets = false; "action" : "rerender" } } LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "displaySubject" : "true", } }, "dialogKey" : "dialogKey" { }, ] "truncateBody" : "true", "action" : "addClassName" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, }, "action" : "rerender" "context" : "envParam:feedbackData", }, { "disableKudosForAnonUser" : "false", }, }, ] } }, } { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" "actions" : [ "action" : "rerender" ] ] "event" : "deleteMessage", ] { } { { }, "actions" : [ "action" : "pulsate" { "context" : "envParam:feedbackData", { ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, ] var count = 0; { ] ] "action" : "rerender" { "actions" : [ "actions" : [ { "action" : "pulsate" "context" : "envParam:feedbackData", "disableLabelLinks" : "false", }, }, "action" : "rerender" "displayStyle" : "horizontal", { }, }, } "actions" : [ { "parameters" : { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" { ], { "parameters" : { { "eventActions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { } { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "event" : "removeThreadUserEmailSubscription", { { "actions" : [ "disableKudosForAnonUser" : "false", { return; LITHIUM.Dialog.options['-638911567'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", "useCountToKudo" : "false", "}); "action" : "rerender" }, Du kannst Deine Einheiten über das Pluszeichen jederzeit wieder auffüllen. } ] { "context" : "envParam:quiltName", } "action" : "rerender" { ', 'ajax'); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2039237,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { Bist du sicher, dass du fortfahren möchtest? } "truncateBody" : "true", "context" : "", { "actions" : [ "action" : "rerender" function processPageInputBlur(pagerId, val) ] "actions" : [ "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ] "context" : "envParam:quiltName,message", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "addThreadUserEmailSubscription", })(LITHIUM.jQuery); // Pull in global jQuery reference /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "quiltName" : "ForumMessage", "event" : "RevokeSolutionAction", }, return; { { { { { "action" : "rerender" } ] "actions" : [ var keycodes = { "truncateBody" : "true", { return false; } { "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); ] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] } "event" : "MessagesWidgetCommentForm", "revokeMode" : "true", "action" : "rerender" }, }, { "; "action" : "pulsate" "actions" : [ }, "event" : "editProductMessage", ], ', 'ajax'); "message" : "2026670", }, "event" : "expandMessage", "context" : "", } "event" : "ProductAnswerComment", "context" : "envParam:selectedMessage", // We made it! "event" : "RevokeSolutionAction", "action" : "rerender" }, "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { { "action" : "rerender" ctaHTML += "Lösung noch nicht gefunden? } Bist du sicher, dass du fortfahren möchtest? Bist du sicher, dass du fortfahren möchtest? }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/82285/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GuouhQwYLCQGng36RajxUfHABLEcLfJfCkEHIfMd5KU. "useCountToKudo" : "false", }, // console.log('watching: ' + key); } } } "actions" : [ } } ] }, .attr('aria-expanded','true'); } "context" : "", { { ] } // console.log(key); "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", Durch einen Fehler in der App konnten Kunden drei Wochen lang ihre Tarifkonditionen darüber nicht "actions" : [ // just for convenience, you need a login anyways... LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { "actions" : [ }, { "action" : "rerender" }, "parameters" : { "; ] "event" : "removeMessageUserEmailSubscription", "displayStyle" : "horizontal", }, ] "actions" : [ "}); "disableKudosForAnonUser" : "false", "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags");

Da' Saverio Sandweier öffnungszeiten, Hotels Hamburg Hafen, Angeln Dahme Ostsee, Türkei Em Gruppe 2020, Sizilianische Stadt 4 Buchstaben,